PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EPS59701.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea
Family MYB_related
Protein Properties Length: 168aa    MW: 19164.6 Da    PI: 9.8088
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EPS59701.1genomeLSMUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding45.61.7e-141761147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     r rW++ E++++v+a k++G   W+ I +++  ++t+ q++s+ qk+
       EPS59701.1 17 RERWSEAEHLRFVEALKLYGRS-WRQIEEHVA-TKTAIQIRSHAQKF 61
                     78******************55.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466894.64E-151166IPR009057Homeodomain-like
PROSITE profilePS5129419.0771266IPR017930Myb domain
TIGRFAMsTIGR015577.4E-161564IPR006447Myb domain, plants
SMARTSM007177.8E-111664IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.1E-71757IPR009057Homeodomain-like
PfamPF002492.8E-111760IPR001005SANT/Myb domain
CDDcd001671.84E-81962No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0007623Biological Processcircadian rhythm
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0009845Biological Processseed germination
GO:0009909Biological Processregulation of flower development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 168 aa     Download sequence    Send to blast
MGSDSKVRKP YTITKQRERW SEAEHLRFVE ALKLYGRSWR QIEEHVATKT AIQIRSHAQK  60
FFAKVTRDSG VCRGEWSLNP DDIPPPRPKK KPVHPYPRKR SSSSAKEVEN VSFLDGDDNK  120
YSPSSVLSPL ASSDNLDVDK NSPNTDDLFA RIPSPDDKFA TVIIIIHY
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011072048.11e-42PREDICTED: protein REVEILLE 7-like isoform X1
RefseqXP_011072049.18e-43PREDICTED: protein REVEILLE 7-like isoform X2
SwissprotF4K5X65e-43RVE2_ARATH; Protein REVEILLE 2
TrEMBLS8C5I11e-122S8C5I1_9LAMI; Uncharacterized protein
STRINGBra039503.1-P1e-41(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA74472127
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G37260.19e-36MYB_related family protein
Publications ? help Back to Top
  1. Leushkin EV, et al.
    The miniature genome of a carnivorous plant Genlisea aurea contains a low number of genes and short non-coding sequences.
    BMC Genomics, 2013. 14: p. 476
    [PMID:23855885]